Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P63692

Expression Region

1-81

Origin

Mycobacterium bovis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mboat7 Pre-designed siRNA Set B
SI108229B 1 Each

Mouse Mboat7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (OTI4E6) [HRP]
NBP2-70204H 0.1 mL

Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (OTI4E6) [HRP]

Sign In for Pricing
View Details
Mouse Pfkfb1 Pre-designed siRNA Set B
SI110410B 1 Each

Mouse Pfkfb1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PGEX-4T-1-STAT3
PPL80013-1b 1 Each

PGEX-4T-1-STAT3

Sign In for Pricing
View Details
Mouse Monoclonal Rab5a Antibody (3A4) [Janelia Fluor 646]
NBP1-04340JF646 0.1 mL

Mouse Monoclonal Rab5a Antibody (3A4) [Janelia Fluor 646]

Sign In for Pricing
View Details
Epb41l3 (NM_053927) Rat Tagged ORF Clone Lentiviral Particle
RR203258L4V 200 µL

Epb41l3 (NM_053927) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details