Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P63692

Expression Region

1-81

Origin

Mycobacterium bovis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7
QY-E10415 96 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7

Sign In for Pricing
View Details
FLT3L Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-10170R-BF594 100 µL

FLT3L Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
IAA Rabbit pAb
E47R0902 100 µL

IAA Rabbit pAb

Sign In for Pricing
View Details
RAB23 (RAB23, Ras-related protein Rab-23) (APC) discontinued
031214-APC 200 µL

RAB23 (RAB23, Ras-related protein Rab-23) (APC) discontinued

Sign In for Pricing
View Details
Anti-AHR Antibody Picoband® (Biotine Conjugate)
A00225-2-Biotin 100 µg/Vial

Anti-AHR Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
FAF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11H10]
TA804157AM 100 µL

FAF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11H10]

Sign In for Pricing
View Details