Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P63692

Expression Region

1-81

Origin

Mycobacterium bovis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cypt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4045608 1.0 µg DNA

Cypt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Rps6ka2 activation kit by CRISPRa
GA203718 1 Kit

Mouse Rps6ka2 activation kit by CRISPRa

Sign In for Pricing
View Details
NGRN sgRNA CRISPR Lentivector (Human) (Target 1)
K1425002 1.0 µg DNA

NGRN sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PRTFDC1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-19446R-BF405 100 µL

PRTFDC1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Otubain-2 Antibody
NBP1-88410-25ul 25 µL

Rabbit Polyclonal Otubain-2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-3 Antibody (rLGALS3/7286) [Allophycocyanin]
NBP3-24178APC 0.1 mL

Mouse Monoclonal Galectin-3 Antibody (rLGALS3/7286) [Allophycocyanin]

Sign In for Pricing
View Details