Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P08445

Expression Region

1-81

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSLTSAASVLAAALAVGLAAIGPGIGQGSAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal COMTD1 Antibody [Allophycocyanin]
NBP2-98181APC 0.1 mL

Rabbit Polyclonal COMTD1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Human GULP1 (PTB domain-containing engulfment adapter protein 1) ELISA Kit
EH9001 96 Tests

Human GULP1 (PTB domain-containing engulfment adapter protein 1) ELISA Kit

Sign In for Pricing
View Details
LIMD1 Rabbit Polyclonal Antibody (Biotin)
orb2111533 100 µL

LIMD1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TAZ Mouse Monoclonal Antibody [Clone ID: OTI5A4]
TA810800 100 µL

TAZ Mouse Monoclonal Antibody [Clone ID: OTI5A4]

Sign In for Pricing
View Details
U2AF1L3 Double Nickase Plasmid (h2)
sc-414979-NIC-2 20 µg

U2AF1L3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Synaptojanin 2 (SYNJ2) Rabbit Polyclonal Antibody
TA345863 100 µL

Synaptojanin 2 (SYNJ2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details