Recombinant Synechococcus sp. ATP synthase subunit c (atpE)
This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
P08445
Expression Region
1-81
Origin
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDSLTSAASVLAAALAVGLAAIGPGIGQGSAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6469163-01 0.2 mL
CLASP1, CT (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (PE)
Sign In for Pricing
View Details MBS6469163-02 5x 0.2 mL
CLASP1, CT (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (PE)
Sign In for Pricing
View Details 
abx145060-01 100 µg
Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Antibody
Sign In for Pricing
View Details