Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P08445

Expression Region

1-81

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSLTSAASVLAAALAVGLAAIGPGIGQGSAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alx4 siRNA Oligos set (Rat)
11816176 3x 5 nmol

Alx4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human CCDC148 shRNA Plasmid
abx965050-01 150 µg

Human CCDC148 shRNA Plasmid

Sign In for Pricing
View Details
Human CCDC148 shRNA Plasmid
abx965050-02 300 µg

Human CCDC148 shRNA Plasmid

Sign In for Pricing
View Details
ARPC3 antibody
OAGA00145-100UL 100 µL

ARPC3 antibody

Sign In for Pricing
View Details
Abcb1a (NM_011076) Mouse Tagged ORF Clone Lentiviral Particle
MR227524L3V 200 µL

Abcb1a (NM_011076) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Vinculin (VCL) ELISA Kit
MBS2611505-01 48 Well

Rat Vinculin (VCL) ELISA Kit

Sign In for Pricing
View Details