Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium ulcerans ATP synthase subunit c (atpE)

This Recombinant Mycobacterium ulcerans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0PUK5

Expression Region

1-81

Origin

Mycobacterium ulcerans (strain Agy99)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCK2 Antibody
orb2673447-01 50 µL

NCK2 Antibody

Sign In for Pricing
View Details
NCK2 Antibody
orb2673447-02 100 µL

NCK2 Antibody

Sign In for Pricing
View Details
NCK2 Antibody
orb2673447-03 200 µL

NCK2 Antibody

Sign In for Pricing
View Details
HP1 gamma (CBX3) (NM_007276) Human Untagged Clone
SC115632 10 µg

HP1 gamma (CBX3) (NM_007276) Human Untagged Clone

Sign In for Pricing
View Details
MAGEB3 Rabbit Polyclonal Antibody
TA367127 100 µL

MAGEB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC103437570 Rabbit Polyclonal Antibody (Cy5.5)
orb1044528 100 µL

LOC103437570 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details