Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gossypium barbadense ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Gossypium barbadense ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0ZZ22

Expression Region

1-81

Origin

Gossypium barbadense (Sea-island cotton) (Egyptian cotton)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALSIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diprotin A
C06878-25mg 25 mg

Diprotin A

Sign In for Pricing
View Details
Rabbit urotensin II (UII) ELISA Kit
MBS2600347-01 48 Well

Rabbit urotensin II (UII) ELISA Kit

Sign In for Pricing
View Details
Rabbit urotensin II (UII) ELISA Kit
MBS2600347-02 96 Well

Rabbit urotensin II (UII) ELISA Kit

Sign In for Pricing
View Details
Rabbit urotensin II (UII) ELISA Kit
MBS2600347-03 5x 96 Well

Rabbit urotensin II (UII) ELISA Kit

Sign In for Pricing
View Details
Rabbit urotensin II (UII) ELISA Kit
MBS2600347-04 10x 96 Well

Rabbit urotensin II (UII) ELISA Kit

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL
BNC680296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details