Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorghum bicolor ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Sorghum bicolor ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1E9R9

Expression Region

1-81

Origin

Sorghum bicolor (Sorghum) (Sorghum vulgare)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNS (NM_001031681) Human Over-expression Lysate
LS001497 100 µg

CTNS (NM_001031681) Human Over-expression Lysate

Sign In for Pricing
View Details
SETMAR Lentiviral Activation Particles (h2)
sc-417901-LAC-2 200 µL

SETMAR Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
BCL11A Antibody (C-term)
E45R06182G-1 100 µL

BCL11A Antibody (C-term)

Sign In for Pricing
View Details
Satb1 (NM_001163630) Mouse Tagged Lenti ORF Clone
MR223653L3 10 µg

Satb1 (NM_001163630) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PT7-SpyCatcher003 Plasmid
PVT79143 2 µg

PT7-SpyCatcher003 Plasmid

Sign In for Pricing
View Details
Eukaryotic Human Cluster Of Differentiation 28 (CD28)
RPU59297-01 50 µg

Eukaryotic Human Cluster Of Differentiation 28 (CD28)

Sign In for Pricing
View Details