Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorghum bicolor ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Sorghum bicolor ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1E9R9

Expression Region

1-81

Origin

Sorghum bicolor (Sorghum) (Sorghum vulgare)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Integrin beta 8 Antibody (2723C) [Allophycocyanin/Cy7]
FAB47752APCCY7 0.1 mL

Rabbit Monoclonal Integrin beta 8 Antibody (2723C) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Drebrin (DBN1) (324-343) Guinea Pig Polyclonal Antibody
BP5113 100 µL

Drebrin (DBN1) (324-343) Guinea Pig Polyclonal Antibody

Sign In for Pricing
View Details
ELISA Kit For Inactive dipeptidyl peptidase 10
E0498h 96 Tests

ELISA Kit For Inactive dipeptidyl peptidase 10

Sign In for Pricing
View Details
GLUD1 antibody
FNab03498 100 µg

GLUD1 antibody

Sign In for Pricing
View Details
ATXN2L Antibody
MBS8514528-01 0.1 mg

ATXN2L Antibody

Sign In for Pricing
View Details
ATXN2L Antibody
MBS8514528-02 0.1 mL (AF635)

ATXN2L Antibody

Sign In for Pricing
View Details