Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Agrostis stolonifera ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1EA03

Expression Region

1-81

Origin

Agrostis stolonifera (Creeping bentgrass)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-(2-Hydroxy-3-(isopropylamino)propoxy)-2,3-dihydro-1H-inden-1-one
TRC-H853920-25MG 25 mg

7-(2-Hydroxy-3-(isopropylamino)propoxy)-2,3-dihydro-1H-inden-1-one

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, right lateral
CS715817 5x 5 µm

Tissue FFPE Sections, Breast, right lateral

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF640R conjugate, 0.1mg/mL
BNC400841-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HRP Conjugated Maclura pomifera Lectin (Osage Orange) -MPA-
H-3901-1 2 mg

HRP Conjugated Maclura pomifera Lectin (Osage Orange) -MPA-

Sign In for Pricing
View Details
Human TAS1R3 activation kit by CRISPRa
GA113263 1 Kit

Human TAS1R3 activation kit by CRISPRa

Sign In for Pricing
View Details
Atp6v0a1 Mouse Gene Knockout Kit (CRISPR)
KN501807 1 Kit

Atp6v0a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details