Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Agrostis stolonifera ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1EA03

Expression Region

1-81

Origin

Agrostis stolonifera (Creeping bentgrass)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b (ITGAM) Human Gene Knockout Kit (CRISPR)
KN421743 1 Kit

CD11b (ITGAM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAST4 Antibody
KC-7401-01 50 μL

MAST4 Antibody

Sign In for Pricing
View Details
MAST4 Antibody
KC-7401-02 100 µL

MAST4 Antibody

Sign In for Pricing
View Details
MAST4 Antibody
KC-7401-03 1 mL

MAST4 Antibody

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF568 conjugate, 0.1mg/mL
BNC681692-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAD52 (Ab-104) Antibody
8B1119-AAT 50 µg

RAD52 (Ab-104) Antibody

Sign In for Pricing
View Details