Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azoarcus sp. ATP synthase subunit c (atpE)

This Recombinant Azoarcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1K1R7

Expression Region

1-81

Origin

Azoarcus sp. (strain BH72)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELMNALQTKMFLLAGLID AAFLIGVGIAMMFAFANPFQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hsp70 1A Monoclonal Antibody
E-AB-81567-01 50 µL

Recombinant Hsp70 1A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Hsp70 1A Monoclonal Antibody
E-AB-81567-02 100 µL

Recombinant Hsp70 1A Monoclonal Antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®555 Antibody Labeling Kit, 1x (20-50ug) labeling
#92254 1 Kit

Mix-n-StainTM CF®555 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
ICK Antibody
8C11905-AAT 50 µg

ICK Antibody

Sign In for Pricing
View Details
FUNDC2 Rabbit Polyclonal Antibody
TA366146 100 µL

FUNDC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody
HA723162 100 µL

Dopamine D2 Receptor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details