Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

This Recombinant Mycobacterium sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1UJY9

Expression Region

1-81

Origin

Mycobacterium sp. (strain KMS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr517 Protein Vector (Mouse) (pPM-C-HA)
PV210760 500 ng

Olfr517 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SARS-CoV-2 S protein (D614G), His Tag, Super stable trimer (MALS verified)
SPN-C52H3-500ug 500 µg

SARS-CoV-2 S protein (D614G), His Tag, Super stable trimer (MALS verified)

Sign In for Pricing
View Details
RPS11P7 ORF Vector (Human) (pORF)
42051011 1.0 µg DNA

RPS11P7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human ATG9A Pre-designed siRNA Set B
SI001218B 1 Each

Human ATG9A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse AKT2 Matched Antibody Pair Set [ABP-S-02157]
ABP-S-02157 5 Plates

Mouse AKT2 Matched Antibody Pair Set [ABP-S-02157]

Sign In for Pricing
View Details
Rat Dynein Heavy Chain 10, Axonemal (DNAH10) ELISA Kit
MBS9942283-01 48 Well

Rat Dynein Heavy Chain 10, Axonemal (DNAH10) ELISA Kit

Sign In for Pricing
View Details