Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

This Recombinant Mycobacterium sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1UJY9

Expression Region

1-81

Origin

Mycobacterium sp. (strain KMS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Alpha-2-macroglobulin receptor-associated protein (LRPAP1) ELISA kit
GTR10476033 96 Well

Monkey Alpha-2-macroglobulin receptor-associated protein (LRPAP1) ELISA kit

Sign In for Pricing
View Details
Mouse Peroxiredoxin 4 (PRDX4) ELISA Kit
EKN47666 96 Tests

Mouse Peroxiredoxin 4 (PRDX4) ELISA Kit

Sign In for Pricing
View Details
TRMT10A Human Pre-designed siRNA Set A
HY-RS15087 1 Set

TRMT10A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
MYH9 Polyclonal Antibody
E44H10581 100 µL

MYH9 Polyclonal Antibody

Sign In for Pricing
View Details
6-Hydroxy-2-oxo-1,2-dihydro-pyridine-4-carboxylic acid
sc-325931 500 mg

6-Hydroxy-2-oxo-1,2-dihydro-pyridine-4-carboxylic acid

Sign In for Pricing
View Details
Lentiviral human KCNT2 shRNA (UAS) - Lentiviral human KCNT2 shRNA (UAS, GFP) (100)
GTR15082509 1 Vial

Lentiviral human KCNT2 shRNA (UAS) - Lentiviral human KCNT2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details