Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

This Recombinant Mycobacterium sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1UJY9

Expression Region

1-81

Origin

Mycobacterium sp. (strain KMS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMB substrate (1-component) for ELISA
80091 500 mL

TMB substrate (1-component) for ELISA

Sign In for Pricing
View Details
Dog FGF7 (Fibroblast Growth Factor 7) ELISA Kit
EK247959 96 Well

Dog FGF7 (Fibroblast Growth Factor 7) ELISA Kit

Sign In for Pricing
View Details
Rev-Erbα polyclonal antibody
GCP108-01 50 µL

Rev-Erbα polyclonal antibody

Sign In for Pricing
View Details
Rev-Erbα polyclonal antibody
GCP108-02 100 µL

Rev-Erbα polyclonal antibody

Sign In for Pricing
View Details
Zebrafish NFKB1 p105/NFKB1 Rabbit Polyclonal Antibody (Fluoro488)
orb3091228 100 µg

Zebrafish NFKB1 p105/NFKB1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
LINC00477 Human qPCR Primer Pair (NM_144667)
HP217248 200 Reactions

LINC00477 Human qPCR Primer Pair (NM_144667)

Sign In for Pricing
View Details