Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A2BYI0

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9515)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GORAB CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22411124 3x 1.0µg DNA

GORAB CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Goose Host Cell Factor C1 Regulator 1 (HCFC1R1) ELISA Kit
MBS9916518 Inquire

Goose Host Cell Factor C1 Regulator 1 (HCFC1R1) ELISA Kit

Sign In for Pricing
View Details
Bac2A TFA
MBS5800241 Inquire

Bac2A TFA

Sign In for Pricing
View Details
Daglb (NM_001107120) Rat Tagged ORF Clone
RR214653 10 µg

Daglb (NM_001107120) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Resveratrol
S1396-100mg 100 mg

Resveratrol

Sign In for Pricing
View Details
TPD52 (A-6) : m-IgG Fc BP-HRP Bundle
sc-525768 1 Kit

TPD52 (A-6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details