Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A2BYI0

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9515)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Filaggrin Antibody (FLG/1561) [DyLight 650]
NBP2-54366C 100 µL

Mouse Monoclonal Filaggrin Antibody (FLG/1561) [DyLight 650]

Sign In for Pricing
View Details
DNA2 siRNA (Mouse)
orb1834767-01 15 nmol

DNA2 siRNA (Mouse)

Sign In for Pricing
View Details
DNA2 siRNA (Mouse)
orb1834767-02 30 nmol

DNA2 siRNA (Mouse)

Sign In for Pricing
View Details
NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI7E5]
CF801257 100 µg

NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI7E5]

Sign In for Pricing
View Details
FTO Recombinant Antibody, HRP Conjugated
bsm-60733R-HRP 100 µL

FTO Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) dsdA Polyclonal Antibody
MBS9003128 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) dsdA Polyclonal Antibody

Sign In for Pricing
View Details