Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A2BYI0

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9515)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M6-201-461 Pre-sized Labels for Printers
174091 100 Box (100 Label (s) x 1 Roll)

M6-201-461 Pre-sized Labels for Printers

Sign In for Pricing
View Details
ADAM5 (A Disintegrin And Metalloproteinase 5, ADAM5P, TMDCII) (MaxLight 405)
MBS6405469-01 0.1 mL

ADAM5 (A Disintegrin And Metalloproteinase 5, ADAM5P, TMDCII) (MaxLight 405)

Sign In for Pricing
View Details
ADAM5 (A Disintegrin And Metalloproteinase 5, ADAM5P, TMDCII) (MaxLight 405)
MBS6405469-02 5x 0.1 mL

ADAM5 (A Disintegrin And Metalloproteinase 5, ADAM5P, TMDCII) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans B0464.6 Protein (aa 1-643)
VAng-Ly3060-inquire Inquire

Recombinant Caenorhabditis Elegans B0464.6 Protein (aa 1-643)

Sign In for Pricing
View Details
Human PTPNS1L2 (SIRPD) activation kit by CRISPRa
GA115055 1 Kit

Human PTPNS1L2 (SIRPD) activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Anti neutrophil cytoplasm class IgA antibody ELISA kit
GTR14673819 96 Well

Rabbit Anti neutrophil cytoplasm class IgA antibody ELISA kit

Sign In for Pricing
View Details