Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A2BT29

Expression Region

1-81

Origin

Prochlorococcus marinus (strain AS9601)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPR2 (NM_016576) Human Tagged ORF Clone
RC203584 10 µg

GMPR2 (NM_016576) Human Tagged ORF Clone

Sign In for Pricing
View Details
CCL2 Antibody (Biotin)
orb1216954 50 µg

CCL2 Antibody (Biotin)

Sign In for Pricing
View Details
PLCL2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36955154 3x 1.0 µg DNA

PLCL2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
SAR1B Antibody
orb653270 100 µL

SAR1B Antibody

Sign In for Pricing
View Details
ASH1L-IT1 Protein Vector (Human) (pPB-His-GST)
PV324315 500 ng

ASH1L-IT1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
OR51S1 Rabbit Polyclonal Antibody (FITC)
orb2085303 100 µL

OR51S1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details