Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A3PEU3

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9301)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032B-01 25 µg

Biotin Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Biotin Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032B-02 100 µg

Biotin Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Claudin 5 (CLDN5) (NM_001130861) Human Over-expression Lysate
LY427293 100 µg

Claudin 5 (CLDN5) (NM_001130861) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF647 conjugate, 0.1mg/mL
BNC470887-100 1x 100 µL

Cytochrome C (CTC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trigonelline
TRC-T794000-50MG 50 mg

Trigonelline

Sign In for Pricing
View Details
PSMA (FOLH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]
TA813986AM 100 µL

PSMA (FOLH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]

Sign In for Pricing
View Details