Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A3PEU3

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9301)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1F Antibody (N-term)
MBS9201574-01 0.08 mL

PPM1F Antibody (N-term)

Sign In for Pricing
View Details
PPM1F Antibody (N-term)
MBS9201574-02 0.4 mL

PPM1F Antibody (N-term)

Sign In for Pricing
View Details
PPM1F Antibody (N-term)
MBS9201574-03 5x 0.4 mL

PPM1F Antibody (N-term)

Sign In for Pricing
View Details
Thumb Dressing Forceps
0329-4 6 Inches

Thumb Dressing Forceps

Sign In for Pricing
View Details
Human recombinant Thrombomodulin/BDCA-3 protein
PROTP07204-1-100ug 100 µg

Human recombinant Thrombomodulin/BDCA-3 protein

Sign In for Pricing
View Details
GRIN2C antibody (Ser1244)
MBS837300-01 0.1 mL

GRIN2C antibody (Ser1244)

Sign In for Pricing
View Details