Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A3M139

Expression Region

1-81

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S146 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV743659 1.0 µg DNA

RN5S146 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GAUT9 Polyclonal Antibody
MBS9010946 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GAUT9 Polyclonal Antibody

Sign In for Pricing
View Details
WDR62 (H-1) P
sc-514865 P 100 µg - 0.5 mL

WDR62 (H-1) P

Sign In for Pricing
View Details
EpCAM (14E9) Rabbit Monoclonal Antibody
E28M2778 100 µL

EpCAM (14E9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HTRA1 discontinued
537624-01 30ul

HTRA1 discontinued

Sign In for Pricing
View Details
HTRA1 discontinued
537624-02 100 µL

HTRA1 discontinued

Sign In for Pricing
View Details