Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A3M139

Expression Region

1-81

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MOCS1 Antibody Picoband®, iFluor647 Conjugate
A07628-2-iFluor647 100 µg

Anti-MOCS1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS707909 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Recombinant Human Gamma-aminobutyric acid receptor subunit epsilon (N-His-SUMO)
BP2222-50ug 50 µg

Recombinant Human Gamma-aminobutyric acid receptor subunit epsilon (N-His-SUMO)

Sign In for Pricing
View Details
EYS (NM_198283) Human Over-expression Lysate
E45H16172-2 20 µg

EYS (NM_198283) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase DCLK1 (DCLK1) ELISA Kit
AE47767MO-01 48 Tests

Mouse Serine/threonine-protein kinase DCLK1 (DCLK1) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase DCLK1 (DCLK1) ELISA Kit
AE47767MO-02 96 Tests

Mouse Serine/threonine-protein kinase DCLK1 (DCLK1) ELISA Kit

Sign In for Pricing
View Details