Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A3M139

Expression Region

1-81

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bortezomib
C07434-10mM/1mL 10 mM/1mL

Bortezomib

Sign In for Pricing
View Details
hCG beta (CGB7) (NM_033142) Human Tagged ORF Clone
RG208311 10 µg

hCG beta (CGB7) (NM_033142) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human FGF19 Protein
E30PQ118 20 µg

Recombinant Human FGF19 Protein

Sign In for Pricing
View Details
Matrix Metalloproteinase 12 (MMP12) BioAssayTM ELISA Kit (Rat)
026706 96 Tests

Matrix Metalloproteinase 12 (MMP12) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Car3 (NM_007606) Mouse Tagged ORF Clone
MR203389 10 µg

Car3 (NM_007606) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
2,3,5,6-Tetramethyl-p-phenylenediamine
420003-01 250 mg

2,3,5,6-Tetramethyl-p-phenylenediamine

Sign In for Pricing
View Details