Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Populus trichocarpa ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4GYP5

Expression Region

1-81

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromium (III) fluoride trihydrate
PC2077Y 1 Each

Chromium (III) fluoride trihydrate

Sign In for Pricing
View Details
Lentiviral mouse Vmn2r81 shRNA (UAS) - Lentiviral mouse Vmn2r81 shRNA (UAS, RFP) (100)
GTR15254520 1 Vial

Lentiviral mouse Vmn2r81 shRNA (UAS) - Lentiviral mouse Vmn2r81 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
OR5H7P Protein Vector (Human) (pPM-C-HA)
PV108028 500 ng

OR5H7P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Galectin 7 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5809R-APC-Cy5.5 100 µL

Galectin 7 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human AMPK (A2/B1/G3) (N-GST/C-His tag)
Z500025 10 µg

Recombinant Human AMPK (A2/B1/G3) (N-GST/C-His tag)

Sign In for Pricing
View Details
Human IgG Antibody
orb153355 100 µL

Human IgG Antibody

Sign In for Pricing
View Details