Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsella bursa-pastoris ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Capsella bursa-pastoris ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QKH9

Expression Region

1-81

Origin

Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLVSAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC17 (NM_001190182) Human Over-expression Lysate
LC434337 20 µg

CCDC17 (NM_001190182) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF704 activation kit by CRISPRa
GA118649 1 Kit

Human ZNF704 activation kit by CRISPRa

Sign In for Pricing
View Details
Nucleolin (364-5), Biotin conjugate, 0.1mg/mL
BNCB0527-100 1x 100 µL

Nucleolin (364-5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C2orf88 (NM_001042520) Human Recombinant Protein
TP313362 20 µg

C2orf88 (NM_001042520) Human Recombinant Protein

Sign In for Pricing
View Details
Polink-2 Plus HRP Sheep IgG DAB Detection Kit
D85-6 1 mL

Polink-2 Plus HRP Sheep IgG DAB Detection Kit

Sign In for Pricing
View Details
Phospho-Src (Y419) Recombinant Rabbit Monoclonal Antibody [ST0800]
ET1609-15 100 µL

Phospho-Src (Y419) Recombinant Rabbit Monoclonal Antibody [ST0800]

Sign In for Pricing
View Details