Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsella bursa-pastoris ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Capsella bursa-pastoris ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QKH9

Expression Region

1-81

Origin

Capsella bursa-pastoris (Shepherd's purse) (Thlaspi bursa-pastoris)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLVSAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urolithin A
SIH-610-25MG 25 mg

Urolithin A

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF740 conjugate, 0.1mg/mL
BNC742602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso-N-ethylbutylamine
TRC-N525810-25MG 25 mg

N-Nitroso-N-ethylbutylamine

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3083), CF740 conjugate, 0.1mg/mL
BNC743083-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3083), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human TNNI3/cTn-I (Troponin I Type 3, Cardiac) ELISA Kit
E-UNEL-H0013-01 5x 96 Tests

Uncoated Human TNNI3/cTn-I (Troponin I Type 3, Cardiac) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TNNI3/cTn-I (Troponin I Type 3, Cardiac) ELISA Kit
E-UNEL-H0013-02 15x 96 Tests

Uncoated Human TNNI3/cTn-I (Troponin I Type 3, Cardiac) ELISA Kit

Sign In for Pricing
View Details