Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Barbarea verna ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Barbarea verna ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QK92

Expression Region

1-81

Origin

Barbarea verna (Land cress) (Early yellowrocket)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF2 Human Gene Knockout Kit (CRISPR)
KN210042 1 Kit

KLF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OSCAR (NM_133169) Human Over-expression Lysate
LC403334 20 µg

OSCAR (NM_133169) Human Over-expression Lysate

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) Human Knockdown Lysate
LY300105 100 µg

p27 KIP 1 (CDKN1B) Human Knockdown Lysate

Sign In for Pricing
View Details
Epsin 1 (EPN1) (NM_001130071) Human Over-expression Lysate
LC427145 20 µg

Epsin 1 (EPN1) (NM_001130071) Human Over-expression Lysate

Sign In for Pricing
View Details
CB-839
TRC-C227095-5MG 5 mg

CB-839

Sign In for Pricing
View Details
Cal-520ER™ AM
21149-AAT 10x 50 µg

Cal-520ER™ AM

Sign In for Pricing
View Details