Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Barbarea verna ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Barbarea verna ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QK92

Expression Region

1-81

Origin

Barbarea verna (Land cress) (Early yellowrocket)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Oleoyl-1-stearoyl-sn-glycero-3-phosphocholine
TRC-O532915-10MG 10 mg

2-Oleoyl-1-stearoyl-sn-glycero-3-phosphocholine

Sign In for Pricing
View Details
ADARB1 Antibody
8C10800-AAT 50 µg

ADARB1 Antibody

Sign In for Pricing
View Details
Amelotin (AMTN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D9]
TA808526AM 100 µL

Amelotin (AMTN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D9]

Sign In for Pricing
View Details
BLOC1S2 Antibody
KC-1221-01 50 μL

BLOC1S2 Antibody

Sign In for Pricing
View Details
BLOC1S2 Antibody
KC-1221-02 100 µL

BLOC1S2 Antibody

Sign In for Pricing
View Details
BLOC1S2 Antibody
KC-1221-03 1 mL

BLOC1S2 Antibody

Sign In for Pricing
View Details