Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lepidium virginicum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QL93

Expression Region

1-81

Origin

Lepidium virginicum (Virginia pepperweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Left-right Determination Factor 2/Lefty-A (N-6His)
CS50-50ug 50 µg

Recombinant Human Left-right Determination Factor 2/Lefty-A (N-6His)

Sign In for Pricing
View Details
Interleukin 15 (IL-15) (APC)
MBS6483062-01 0.1 mL

Interleukin 15 (IL-15) (APC)

Sign In for Pricing
View Details
Interleukin 15 (IL-15) (APC)
MBS6483062-02 5x 0.1 mL

Interleukin 15 (IL-15) (APC)

Sign In for Pricing
View Details
EYA1 Antibody (N-term)
E45R30952G-1 100 µL

EYA1 Antibody (N-term)

Sign In for Pricing
View Details
LARP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1196806 1.0 µg DNA

LARP6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PROX-1-S514 Rabbit pAb
MBS8559110-01 0.1 mL

PROX-1-S514 Rabbit pAb

Sign In for Pricing
View Details