Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lepidium virginicum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QL93

Expression Region

1-81

Origin

Lepidium virginicum (Virginia pepperweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia hermsii Membrane protein insertase YidC (yidC)
MBS7034571-01 0.02 mg

Recombinant Borrelia hermsii Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Borrelia hermsii Membrane protein insertase YidC (yidC)
MBS7034571-02 0.1 mg

Recombinant Borrelia hermsii Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Borrelia hermsii Membrane protein insertase YidC (yidC)
MBS7034571-03 5x 0.1 mg

Recombinant Borrelia hermsii Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Human GDP-mannose 4,6 dehydratase, GMDS ELISA KIT
ELI-27340h 96 Tests

Human GDP-mannose 4,6 dehydratase, GMDS ELISA KIT

Sign In for Pricing
View Details
Chondroitinase Antibody
E51A05882 100 µL

Chondroitinase Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0758 protein SPJ_1027 (SPJ_1027)
MBS1072537-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0758 protein SPJ_1027 (SPJ_1027)

Sign In for Pricing
View Details