Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lobularia maritima ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lobularia maritima ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4QLI1

Expression Region

1-81

Origin

Lobularia maritima (Sweet alyssum) (Alyssum maritimum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF405S conjugate, 0.1mg/mL
BNC041921-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TEX53 activation kit by CRISPRa
GA119721 1 Kit

Human TEX53 activation kit by CRISPRa

Sign In for Pricing
View Details
Tasp1 Mouse Gene Knockout Kit (CRISPR)
KN517224 1 Kit

Tasp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Taz Mouse Gene Knockout Kit (CRISPR)
KN517231 1 Kit

Taz Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NEDD8 Recombinant Rabbit Monoclonal Antibody [JF69-09]
ET1702-84 100 µL

NEDD8 Recombinant Rabbit Monoclonal Antibody [JF69-09]

Sign In for Pricing
View Details
Human CSPG4 Recombinant Rabbit monoclonal Antibody
HA723246 100 µL

Human CSPG4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details