Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium tuberculosis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5U204

Expression Region

1-81

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Proteoglycan 4 (PRG4) ELISA Kit
EK8292 48 Tests

Rat Proteoglycan 4 (PRG4) ELISA Kit

Sign In for Pricing
View Details
RAD9B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV639229 1.0 µg DNA

RAD9B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Chicken IgM Heavy Chain Secondary Antibody [Allophycocyanin]
NBP2-60690APC 0.5 mL

Goat Polyclonal Goat anti-Chicken IgM Heavy Chain Secondary Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Monoclonal E. Coli J5 LPS Antibody (2D7/1)
NB100-64543 0.1 mg

Mouse Monoclonal E. Coli J5 LPS Antibody (2D7/1)

Sign In for Pricing
View Details
Remimazolam D3
CS-O-35457 1 Each

Remimazolam D3

Sign In for Pricing
View Details
PE Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody
MBS4514655-01 0.025 mg

PE Anti-Mouse Ly-6G/Ly-6C (Gr-1) Antibody

Sign In for Pricing
View Details