Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium tuberculosis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5U204

Expression Region

1-81

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL3 Double Nickase Plasmid (h2)
sc-416856-NIC-2 20 µg

ARL3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Vill (NM_001164567) Mouse Tagged ORF Clone
MG215823 10 µg

Vill (NM_001164567) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Olr748 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV637734 1.0 µg DNA

Olr748 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Prostaglandin E2 (PGE2) ELISA Kit
EKU06858 96 Tests

Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details
1-Cyclohexyl-3- (2- (4-morpholinyl) ethyl) carbodiimide
FC64700-01 25 mg

1-Cyclohexyl-3- (2- (4-morpholinyl) ethyl) carbodiimide

Sign In for Pricing
View Details
1-Cyclohexyl-3- (2- (4-morpholinyl) ethyl) carbodiimide
FC64700-02 50 mg

1-Cyclohexyl-3- (2- (4-morpholinyl) ethyl) carbodiimide

Sign In for Pricing
View Details