Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium tuberculosis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5U204

Expression Region

1-81

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC4A9 Antibody
OACA10634-50UG 50 µg

SLC4A9 Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD 336-347 peptide
PP51101 1 mg

SARS-CoV-2 Spike RBD 336-347 peptide

Sign In for Pricing
View Details
PRKAA1/PRKAA2 Antibody
orb572165 100 µL

PRKAA1/PRKAA2 Antibody

Sign In for Pricing
View Details
Pomt2 3'UTR Luciferase Stable Cell Line
TU216555 1.0 mL

Pomt2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FURIN Rabbit mAb
E51A08407 100 µL

FURIN Rabbit mAb

Sign In for Pricing
View Details
BG45
T2294-01 1 mL - 10 mM (in DMSO)

BG45

Sign In for Pricing
View Details