Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buxus microphylla ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Buxus microphylla ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A6MM23

Expression Region

1-81

Origin

Buxus microphylla (Little leaf boxwood) (Japanese boxwood)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY4 Polyclonal Antibody
E-AB-10740-01 20 µL

ADCY4 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY4 Polyclonal Antibody
E-AB-10740-02 60 µL

ADCY4 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY4 Polyclonal Antibody
E-AB-10740-03 120 µL

ADCY4 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY4 Polyclonal Antibody
E-AB-10740-04 200 µL

ADCY4 Polyclonal Antibody

Sign In for Pricing
View Details
Human nkx6.2 (NKX6-2) activation kit by CRISPRa
GA113571 1 Kit

Human nkx6.2 (NKX6-2) activation kit by CRISPRa

Sign In for Pricing
View Details
CD56 / NCAM (123A8, same as 56C04), CF568 conjugate, 0.1mg/mL
BNC680692-500 1x 500 µL

CD56 / NCAM (123A8, same as 56C04), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details