Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii ATP synthase subunit C, plastid (atpE)

This Recombinant Cuscuta gronovii ATP synthase subunit C, plastid (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit C, plastid, ATP synthase F0 sector subunit C, ATPase subunit III, Lipid-binding protein

UniProt

A7M8Z1

Expression Region

1-81

Origin

Cuscuta gronovii (Common dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAT5 (ABHD16A) Human qPCR Template Standard (NM_021160)
HK201053 1 Kit

BAT5 (ABHD16A) Human qPCR Template Standard (NM_021160)

Sign In for Pricing
View Details
Human TXLNb (Taxilin Beta) ELISA Kit
RE1813H-01 48 Tests

Human TXLNb (Taxilin Beta) ELISA Kit

Sign In for Pricing
View Details
Human TXLNb (Taxilin Beta) ELISA Kit
RE1813H-02 96 Tests

Human TXLNb (Taxilin Beta) ELISA Kit

Sign In for Pricing
View Details
Cyclin I Rabbit pAb
E45R23846N 50 ul

Cyclin I Rabbit pAb

Sign In for Pricing
View Details
Recombinant Coix lachryma-jobi Bowman-Birk type trypsin inhibitor TI1
MBS1003894-01 0.02 mg (E-Coli)

Recombinant Coix lachryma-jobi Bowman-Birk type trypsin inhibitor TI1

Sign In for Pricing
View Details
Recombinant Coix lachryma-jobi Bowman-Birk type trypsin inhibitor TI1
MBS1003894-02 0.1 mg (E-Coli)

Recombinant Coix lachryma-jobi Bowman-Birk type trypsin inhibitor TI1

Sign In for Pricing
View Details