Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii ATP synthase subunit C, plastid (atpE)

This Recombinant Cuscuta gronovii ATP synthase subunit C, plastid (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit C, plastid, ATP synthase F0 sector subunit C, ATPase subunit III, Lipid-binding protein

UniProt

A7M8Z1

Expression Region

1-81

Origin

Cuscuta gronovii (Common dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Furoyl-LIGRLO-amide trifluoroacetate salt
sc-213814 1 mg

2-Furoyl-LIGRLO-amide trifluoroacetate salt

Sign In for Pricing
View Details
Carboxyrhodamine 110-PEG4-alkyne
orb1989323-01 100 mg

Carboxyrhodamine 110-PEG4-alkyne

Sign In for Pricing
View Details
Carboxyrhodamine 110-PEG4-alkyne
orb1989323-02 500 mg

Carboxyrhodamine 110-PEG4-alkyne

Sign In for Pricing
View Details
HX-1500-3-WT-J AB Labels
117310 Roll of 1000 Label(s)

HX-1500-3-WT-J AB Labels

Sign In for Pricing
View Details
NDUFA2 (NM_002488) Human Untagged Clone
SC118616 10 µg

NDUFA2 (NM_002488) Human Untagged Clone

Sign In for Pricing
View Details
C9orf131 Rabbit Polyclonal Antibody (Cy3)
orb986339 100 µL

C9orf131 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details