Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8G6V5

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9215)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX5L Rabbit Polyclonal Antibody (Cy5)
orb918138 100 µL

PEX5L Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster GTPase-activating protein (Gap1), partial
MBS1101990 Inquire

Recombinant Drosophila melanogaster GTPase-activating protein (Gap1), partial

Sign In for Pricing
View Details
ATP5LP4 Protein Vector (Human) (pPM-N-D-C-His)
PV325321 500 ng

ATP5LP4 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Low Sample Volume Human Interleukin 2 (IL2) ELISA Kit
abx052042-01 96 Tests

Low Sample Volume Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Human Interleukin 2 (IL2) ELISA Kit
abx052042-02 5x 96 Tests

Low Sample Volume Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Human Interleukin 2 (IL2) ELISA Kit
abx052042-03 10x 96 Tests

Low Sample Volume Human Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details