Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8G6V5

Expression Region

1-81

Origin

Prochlorococcus marinus (strain MIT 9215)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NIPA-like protein 2 (NIPAL2) ELISA Kit
MBS283917-01 48 Tests

Human NIPA-like protein 2 (NIPAL2) ELISA Kit

Sign In for Pricing
View Details
Human NIPA-like protein 2 (NIPAL2) ELISA Kit
MBS283917-02 96 Tests

Human NIPA-like protein 2 (NIPAL2) ELISA Kit

Sign In for Pricing
View Details
Human NIPA-like protein 2 (NIPAL2) ELISA Kit
MBS283917-03 5x 96 Tests

Human NIPA-like protein 2 (NIPAL2) ELISA Kit

Sign In for Pricing
View Details
Human NIPA-like protein 2 (NIPAL2) ELISA Kit
MBS283917-04 10x 96 Tests

Human NIPA-like protein 2 (NIPAL2) ELISA Kit

Sign In for Pricing
View Details
POU6F2 Polyclonal Antibody, PE-Cy5 Conjugated
bs-6084R-PE-Cy5 100 µL

POU6F2 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
TTC38 (FITC)
580326-01 50 µg

TTC38 (FITC)

Sign In for Pricing
View Details