Recombinant Cuscuta exaltata ATP synthase subunit C, plastid (atpE)
This Recombinant Cuscuta exaltata ATP synthase subunit C, plastid (atpE) spans the amino acid sequence from region 1-81.
Product Specifications
Product Name Alternative
ATP synthase subunit C, plastid, ATP synthase F0 sector subunit C, ATPase subunit III, Lipid-binding protein
UniProt
A8W3B1
Expression Region
1-81
Origin
Cuscuta exaltata (Tall dodder)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP51904PU-N 400 µL
Glypican 6 (GPC6) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
