Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lemna minor ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lemna minor ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A9L983

Expression Region

1-81

Origin

Lemna minor (Common duckweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVP Adenovirus (Mouse)
12880054 1.0 mL

AVP Adenovirus (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal RECQ1 Antibody [Alexa Fluor 700]
NB100-619AF700 0.1 mL

Rabbit Polyclonal RECQ1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Thyroid Peroxidase (TPO) Human Over-expression Lysate
orb1362135 20 µg

Thyroid Peroxidase (TPO) Human Over-expression Lysate

Sign In for Pricing
View Details
Ctsh sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
17100114 3x 1.0 µg

Ctsh sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human SLC39A5 Knockout HEK293T cell line
GTR15405567 1 Vial

Human SLC39A5 Knockout HEK293T cell line

Sign In for Pricing
View Details
Serotonin hydrochloride
orb1306100-01 25 mg

Serotonin hydrochloride

Sign In for Pricing
View Details