Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lemna minor ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lemna minor ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A9L983

Expression Region

1-81

Origin

Lemna minor (Common duckweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

phospho-Met (c-Met) (Tyr1349) Rabbit mAb
MBS4754118-01 0.1 mL

phospho-Met (c-Met) (Tyr1349) Rabbit mAb

Sign In for Pricing
View Details
phospho-Met (c-Met) (Tyr1349) Rabbit mAb
MBS4754118-02 5x 0.1 mL

phospho-Met (c-Met) (Tyr1349) Rabbit mAb

Sign In for Pricing
View Details
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E11]
TA806790BM 100 µL

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E11]

Sign In for Pricing
View Details
Rabbit glutaminase (GLS) ELISA Kit
EIA07202Rb 1 Kit

Rabbit glutaminase (GLS) ELISA Kit

Sign In for Pricing
View Details
Eukaryotic Kallistatin (KAL)
TRV-0019725-01 10 µg

Eukaryotic Kallistatin (KAL)

Sign In for Pricing
View Details
Eukaryotic Kallistatin (KAL)
TRV-0019725-02 50 µg

Eukaryotic Kallistatin (KAL)

Sign In for Pricing
View Details