Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brachypodium distachyon ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Brachypodium distachyon ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3TN46

Expression Region

1-81

Origin

Brachypodium distachyon (Purple false brome) (Trachynia distachya)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-Chlorophenyl) -5- (propan-2-yl) -1H-pyrazol-4-amine
IKC22754-01 250 mg

1- (4-Chlorophenyl) -5- (propan-2-yl) -1H-pyrazol-4-amine

Sign In for Pricing
View Details
1- (4-Chlorophenyl) -5- (propan-2-yl) -1H-pyrazol-4-amine
IKC22754-02 2.5 g

1- (4-Chlorophenyl) -5- (propan-2-yl) -1H-pyrazol-4-amine

Sign In for Pricing
View Details
[UL-13C12]Sucrose
OS29120 50 mg

[UL-13C12]Sucrose

Sign In for Pricing
View Details
HSPD1 Antibody
orb1178109 100 µg

HSPD1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) DAPE Polyclonal Antibody
MBS7184975 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) DAPE Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Antibody
orb1826178-01 20 µg

MGMT Antibody

Sign In for Pricing
View Details