Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brachypodium distachyon ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Brachypodium distachyon ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3TN46

Expression Region

1-81

Origin

Brachypodium distachyon (Purple false brome) (Trachynia distachya)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IIIG9 siRNA (m)
sc-146196 10 µM

IIIG9 siRNA (m)

Sign In for Pricing
View Details
Rabbit Monoclonal ACOX1 Antibody (102) [Alexa Fluor 750]
NBP2-89866AF750 0.1 mL

Rabbit Monoclonal ACOX1 Antibody (102) [Alexa Fluor 750]

Sign In for Pricing
View Details
Monoacylglycerol Lipase (mgLL) Mouse Monoclonal Antibody [Clone:1A1]
E45M11266 100 µg

Monoacylglycerol Lipase (mgLL) Mouse Monoclonal Antibody [Clone:1A1]

Sign In for Pricing
View Details
PJA2 ORF Vector (Human) (pORF)
ORF007873 1.0 µg DNA

PJA2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral human MAN2C1 shRNA (UAS) - Lentiviral human MAN2C1 shRNA (UAS, iRFP) (100)
GTR15162363 1 Vial

Lentiviral human MAN2C1 shRNA (UAS) - Lentiviral human MAN2C1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Aspergillus giganteus α-sarcin
HY-W791671 1 Each

Aspergillus giganteus α-sarcin

Sign In for Pricing
View Details