Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme ATP synthase subunit c (atpE)

This Recombinant Nostoc punctiforme ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2J054

Expression Region

1-81

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLVQAASVLAAALAIGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVIALVLLFANPFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D10C cDNA Clone
MBS1278863-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TBC1D10C cDNA Clone

Sign In for Pricing
View Details
TBC1D10C cDNA Clone
MBS1278863-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TBC1D10C cDNA Clone

Sign In for Pricing
View Details
Human HPV16 IgG ELISA Kit
E110345 1 Each

Human HPV16 IgG ELISA Kit

Sign In for Pricing
View Details
Phospho-Ezrin-Y353 Rabbit pAb
AP1118-01 20 µL

Phospho-Ezrin-Y353 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Ezrin-Y353 Rabbit pAb
AP1118-02 100 μL

Phospho-Ezrin-Y353 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Ezrin-Y353 Rabbit pAb
AP1118-03 1000 μL

Phospho-Ezrin-Y353 Rabbit pAb

Sign In for Pricing
View Details