Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1XHZ2

Expression Region

1-81

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSLTAAASVIAAALAVGLAAIGPGIGQGNAAGSAAEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a / HTA1 (Mature Langerhans Cells Marker), CF568 conjugate, 0.1mg/mL
BNC681657-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-NED azide
217-AAT 1 mg

6-NED azide

Sign In for Pricing
View Details
Mouse GHR Antibody Pair Set
E-KAB-0347 50 µL & 100 µg

Mouse GHR Antibody Pair Set

Sign In for Pricing
View Details
RON (MST1R) Human Gene Knockout Kit (CRISPR)
KN212786RB 1 Kit

RON (MST1R) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPX
#80012 1x 500 mg

DPX

Sign In for Pricing
View Details
Hexokinase II (HK2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]
TA500856BM 100 µL

Hexokinase II (HK2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]

Sign In for Pricing
View Details