Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2I0Z7

Expression Region

1-81

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRA2A (Alpha-2A Adrenergic Receptor, Alpha-2 Adrenergic Receptor Subtype C10, Alpha-2A Adrenoreceptor, Alpha-2A Adrenoceptor, Alpha-2AAR, ADRA2R, ADRAR)
A0906-64F 100 µg

ADRA2A (Alpha-2A Adrenergic Receptor, Alpha-2 Adrenergic Receptor Subtype C10, Alpha-2A Adrenoreceptor, Alpha-2A Adrenoceptor, Alpha-2AAR, ADRA2R, ADRAR)

Sign In for Pricing
View Details
Guinea Pig Alba like protein C9orf23 (C9orf23) ELISA Kit
GTR10346500 96 Well

Guinea Pig Alba like protein C9orf23 (C9orf23) ELISA Kit

Sign In for Pricing
View Details
Human TNFSF11/RANKL/CD254 Recombinant Protein Mouse IgG Fc Tag Lyophilized
MBS8433615-01 0.05 mg

Human TNFSF11/RANKL/CD254 Recombinant Protein Mouse IgG Fc Tag Lyophilized

Sign In for Pricing
View Details
Human TNFSF11/RANKL/CD254 Recombinant Protein Mouse IgG Fc Tag Lyophilized
MBS8433615-02 5x 0.05 mg

Human TNFSF11/RANKL/CD254 Recombinant Protein Mouse IgG Fc Tag Lyophilized

Sign In for Pricing
View Details
Guinea Pig Phosphorylated c Jun N terminal kinases/stress activated protein kinase ELISA kit
GTR10461960 96 Well

Guinea Pig Phosphorylated c Jun N terminal kinases/stress activated protein kinase ELISA kit

Sign In for Pricing
View Details
Anti-Phospho-CD32B/Fcgr2b (Tyr292) Polyclonal Antibody
TMAC-00698-01 50 μL

Anti-Phospho-CD32B/Fcgr2b (Tyr292) Polyclonal Antibody

Sign In for Pricing
View Details