Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2I0Z7

Expression Region

1-81

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ARF6 Antibody Picoband®, Carrier-free
A00927-2-carrier-free 100 µg/Vial

Anti-ARF6 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Caspase 9 (Cleaved-Asp330)
520951-01 100 µL

Caspase 9 (Cleaved-Asp330)

Sign In for Pricing
View Details
Caspase 9 (Cleaved-Asp330)
520951-02 200 µL

Caspase 9 (Cleaved-Asp330)

Sign In for Pricing
View Details
Mouse CYP27B1 siRNA
abx913370-01 15 nmol

Mouse CYP27B1 siRNA

Sign In for Pricing
View Details
Mouse CYP27B1 siRNA
abx913370-02 30 nmol

Mouse CYP27B1 siRNA

Sign In for Pricing
View Details
pCMV-SKP2-3×Myc-Neo Plasmid
PVT48850 2 µg

pCMV-SKP2-3×Myc-Neo Plasmid

Sign In for Pricing
View Details